FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5138, 125 aa 1>>>pF1KE5138 125 - 125 aa - 125 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.7084+/-0.000322; mu= 13.4388+/- 0.020 mean_var=52.5145+/-10.721, 0's: 0 Z-trim(114.2): 13 B-trim: 0 in 0/54 Lambda= 0.176984 statistics sampled from 23920 (23924) to 23920 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.673), E-opt: 0.2 (0.281), width: 16 Scan time: 4.180 The best scores are: opt bits E(85289) NP_115865 (OMIM: 611973) 28S ribosomal protein S6, ( 125) 806 213.2 9.1e-56 >>NP_115865 (OMIM: 611973) 28S ribosomal protein S6, mit (125 aa) initn: 806 init1: 806 opt: 806 Z-score: 1122.2 bits: 213.2 E(85289): 9.1e-56 Smith-Waterman score: 806; 100.0% identity (100.0% similar) in 125 aa overlap (1-125:1-125) 10 20 30 40 50 60 pF1KE5 MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_115 MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 GGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYST :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_115 GGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYST 70 80 90 100 110 120 pF1KE5 KKRKK ::::: NP_115 KKRKK 125 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:44:03 2016 done: Mon Nov 7 21:44:04 2016 Total Scan time: 4.180 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]