FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5138, 125 aa 1>>>pF1KE5138 125 - 125 aa - 125 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9112+/-0.000687; mu= 12.3146+/- 0.042 mean_var=51.7875+/-10.437, 0's: 0 Z-trim(107.2): 10 B-trim: 0 in 0/50 Lambda= 0.178222 statistics sampled from 9456 (9459) to 9456 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.687), E-opt: 0.2 (0.291), width: 16 Scan time: 1.170 The best scores are: opt bits E(32554) CCDS33548.1 MRPS6 gene_id:64968|Hs108|chr21 ( 125) 806 214.5 1.3e-56 >>CCDS33548.1 MRPS6 gene_id:64968|Hs108|chr21 (125 aa) initn: 806 init1: 806 opt: 806 Z-score: 1129.6 bits: 214.5 E(32554): 1.3e-56 Smith-Waterman score: 806; 100.0% identity (100.0% similar) in 125 aa overlap (1-125:1-125) 10 20 30 40 50 60 pF1KE5 MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS33 MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 GGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYST :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS33 GGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYST 70 80 90 100 110 120 pF1KE5 KKRKK ::::: CCDS33 KKRKK 125 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 21:44:03 2016 done: Mon Nov 7 21:44:03 2016 Total Scan time: 1.170 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]