FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3010, 97 aa 1>>>pF1KE3010 97 - 97 aa - 97 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3528+/-0.000473; mu= 14.8272+/- 0.029 mean_var=56.6238+/-11.145, 0's: 0 Z-trim(115.6): 5 B-trim: 125 in 1/51 Lambda= 0.170441 statistics sampled from 16142 (16147) to 16142 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.848), E-opt: 0.2 (0.496), width: 16 Scan time: 1.640 The best scores are: opt bits E(32554) CCDS32662.1 PYY gene_id:5697|Hs108|chr17 ( 97) 651 166.6 2.2e-42 CCDS5387.1 NPY gene_id:4852|Hs108|chr7 ( 97) 332 88.1 9e-19 >>CCDS32662.1 PYY gene_id:5697|Hs108|chr17 (97 aa) initn: 651 init1: 651 opt: 651 Z-score: 874.4 bits: 166.6 E(32554): 2.2e-42 Smith-Waterman score: 651; 97.9% identity (97.9% similar) in 97 aa overlap (1-97:1-97) 10 20 30 40 50 60 pF1KE3 MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVT :::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::: CCDS32 MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPREDASPEELNRYYASLRHYLNLVT 10 20 30 40 50 60 70 80 90 pF1KE3 RQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW ::::::::::: ::::::::::::::::::::::::: CCDS32 RQRYGKRDGPDTLLSKTFFPDGEDRPVRSRSEGPDLW 70 80 90 >>CCDS5387.1 NPY gene_id:4852|Hs108|chr7 (97 aa) initn: 314 init1: 286 opt: 332 Z-score: 450.5 bits: 88.1 E(32554): 9e-19 Smith-Waterman score: 332; 54.1% identity (80.0% similar) in 85 aa overlap (13-97:13-97) 10 20 30 40 50 60 pF1KE3 MVFVRRPWPALTTVLLALLVCLGALVDAYPIKPEAPGEDASPEELNRYYASLRHYLNLVT :. :.::::::::..::: ::. ::::: :.. :::..::::.::.: CCDS53 MLGNKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGEDAPAEDMARYYSALRHYINLIT 10 20 30 40 50 60 70 80 90 pF1KE3 RQRYGKRDGPDRLLSKTFFPDGEDRPVRSRSEGPDLW :::::::..:. :.: .. .. . :.: : : .: CCDS53 RQRYGKRSSPETLISDLLMRESTENVPRTRLEDPAMW 70 80 90 97 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 12:14:32 2016 done: Sun Nov 6 12:14:33 2016 Total Scan time: 1.640 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]