Result of FASTA (omim) for pFN21AE1610
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1610, 115 aa
  1>>>pF1KE1610 115 - 115 aa - 115 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.0142+/-0.000223; mu= 8.1718+/- 0.014
 mean_var=82.6994+/-16.684, 0's: 0 Z-trim(125.1): 1  B-trim: 2431 in 1/55
 Lambda= 0.141034
 statistics sampled from 48228 (48234) to 48228 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.869), E-opt: 0.2 (0.566), width:  16
 Scan time:  5.440

The best scores are:                                      opt bits E(85289)
NP_004731 (OMIM: 609517) TGFB1-induced anti-apopto ( 115)  810 172.7 1.2e-43


>>NP_004731 (OMIM: 609517) TGFB1-induced anti-apoptotic   (115 aa)
 initn: 810 init1: 810 opt: 810  Z-score: 904.8  bits: 172.7 E(85289): 1.2e-43
Smith-Waterman score: 810; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KE1 MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_004 MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPP
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KE1 APTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_004 APTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
               70        80        90       100       110     




115 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 12:15:38 2016 done: Sun Nov  6 12:15:38 2016
 Total Scan time:  5.440 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com