Result of FASTA (ccds) for pFN21AE1610
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1610, 115 aa
  1>>>pF1KE1610 115 - 115 aa - 115 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.7829+/-0.00047; mu= 9.7979+/- 0.029
 mean_var=82.2779+/-16.473, 0's: 0 Z-trim(117.7): 5  B-trim: 0 in 0/51
 Lambda= 0.141395
 statistics sampled from 18491 (18492) to 18491 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.872), E-opt: 0.2 (0.568), width:  16
 Scan time:  1.910

The best scores are:                                      opt bits E(32554)
CCDS32599.1 TIAF1 gene_id:9220|Hs108|chr17         ( 115)  810 173.0 3.7e-44


>>CCDS32599.1 TIAF1 gene_id:9220|Hs108|chr17              (115 aa)
 initn: 810 init1: 810 opt: 810  Z-score: 906.3  bits: 173.0 E(32554): 3.7e-44
Smith-Waterman score: 810; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KE1 MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS32 MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPP
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KE1 APTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS32 APTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
               70        80        90       100       110     




115 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 12:15:37 2016 done: Sun Nov  6 12:15:37 2016
 Total Scan time:  1.910 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com