FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6564, 180 aa 1>>>pF1KE6564 180 - 180 aa - 180 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.4900+/-0.000678; mu= 11.1760+/- 0.041 mean_var=59.6179+/-11.947, 0's: 0 Z-trim(109.5): 13 B-trim: 0 in 0/51 Lambda= 0.166106 statistics sampled from 10910 (10913) to 10910 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.73), E-opt: 0.2 (0.335), width: 16 Scan time: 1.480 The best scores are: opt bits E(32554) CCDS32511.1 APRT gene_id:353|Hs108|chr16 ( 180) 1178 290.2 4.7e-79 CCDS45546.1 APRT gene_id:353|Hs108|chr16 ( 134) 879 218.5 1.3e-57 >>CCDS32511.1 APRT gene_id:353|Hs108|chr16 (180 aa) initn: 1178 init1: 1178 opt: 1178 Z-score: 1532.8 bits: 290.2 E(32554): 4.7e-79 Smith-Waterman score: 1178; 100.0% identity (100.0% similar) in 180 aa overlap (1-180:1-180) 10 20 30 40 50 60 pF1KE6 MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 IAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 IAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPG 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE6 QRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 QRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE 130 140 150 160 170 180 >>CCDS45546.1 APRT gene_id:353|Hs108|chr16 (134 aa) initn: 879 init1: 879 opt: 879 Z-score: 1147.6 bits: 218.5 E(32554): 1.3e-57 Smith-Waterman score: 879; 100.0% identity (100.0% similar) in 133 aa overlap (1-133:1-133) 10 20 30 40 50 60 pF1KE6 MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS45 MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 IAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS45 IAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPG 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE6 QRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE ::::::::::::: CCDS45 QRVVVVDDLLATGV 130 180 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:26:55 2016 done: Tue Nov 8 14:26:55 2016 Total Scan time: 1.480 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]