FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2268, 128 aa 1>>>pF1KE2268 128 - 128 aa - 128 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0302+/-0.000606; mu= 11.6561+/- 0.036 mean_var=54.9186+/-11.076, 0's: 0 Z-trim(110.6): 14 B-trim: 7 in 1/47 Lambda= 0.173067 statistics sampled from 11692 (11698) to 11692 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.75), E-opt: 0.2 (0.359), width: 16 Scan time: 1.720 The best scores are: opt bits E(32554) CCDS32151.1 TCL1B gene_id:9623|Hs108|chr14 ( 128) 889 229.3 5.1e-61 >>CCDS32151.1 TCL1B gene_id:9623|Hs108|chr14 (128 aa) initn: 889 init1: 889 opt: 889 Z-score: 1208.9 bits: 229.3 E(32554): 5.1e-61 Smith-Waterman score: 889; 100.0% identity (100.0% similar) in 128 aa overlap (1-128:1-128) 10 20 30 40 50 60 pF1KE2 MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSIT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSIT 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE2 VHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS32 VHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVL 70 80 90 100 110 120 pF1KE2 TYQPERKD :::::::: CCDS32 TYQPERKD 128 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 12:21:44 2016 done: Sun Nov 6 12:21:45 2016 Total Scan time: 1.720 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]