FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1650, 164 aa 1>>>pF1KE1650 164 - 164 aa - 164 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.6796+/-0.000273; mu= 10.6173+/- 0.017 mean_var=68.8021+/-13.811, 0's: 0 Z-trim(118.9): 20 B-trim: 1387 in 1/53 Lambda= 0.154623 statistics sampled from 32334 (32354) to 32334 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.772), E-opt: 0.2 (0.379), width: 16 Scan time: 5.850 The best scores are: opt bits E(85289) NP_001014358 (OMIM: 609509) interleukin-31 precurs ( 164) 1076 248.1 4.6e-66 >>NP_001014358 (OMIM: 609509) interleukin-31 precursor [ (164 aa) initn: 1076 init1: 1076 opt: 1076 Z-score: 1307.1 bits: 248.1 E(85289): 4.6e-66 Smith-Waterman score: 1076; 100.0% identity (100.0% similar) in 164 aa overlap (1-164:1-164) 10 20 30 40 50 60 pF1KE1 MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MASHSGPSTSVLFLFCCLGGWLASHTLPVRLLRPSDDVQKIVEELQSLSKMLLKDVEEEK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 GVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 GVLVSQNYTLPCLSPDAQPPNNIHSPAIRAYLKTIRQLDNKSVIDEIIEHLDKLIFQDAP 70 80 90 100 110 120 130 140 150 160 pF1KE1 ETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT :::::::::::::::::::::::::::::::::::::::::::: NP_001 ETNISVPTDTHECKRFILTISQQFSECMDLALKSLTSGAQQATT 130 140 150 160 164 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Wed Nov 9 12:21:46 2016 done: Wed Nov 9 12:21:47 2016 Total Scan time: 5.850 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]