FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3054, 207 aa 1>>>pF1KE3054 207 - 207 aa - 207 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3932+/-0.000283; mu= 14.9239+/- 0.018 mean_var=86.0787+/-17.638, 0's: 0 Z-trim(120.7): 20 B-trim: 1174 in 2/50 Lambda= 0.138238 statistics sampled from 36358 (36382) to 36358 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.776), E-opt: 0.2 (0.427), width: 16 Scan time: 6.260 The best scores are: opt bits E(85289) NP_000724 (OMIM: 186830,615615) T-cell surface gly ( 207) 1442 296.3 2.3e-80 >>NP_000724 (OMIM: 186830,615615) T-cell surface glycopr (207 aa) initn: 1442 init1: 1442 opt: 1442 Z-score: 1563.8 bits: 296.3 E(85289): 2.3e-80 Smith-Waterman score: 1442; 100.0% identity (100.0% similar) in 207 aa overlap (1-207:1-207) 10 20 30 40 50 60 pF1KE3 MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_000 MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_000 HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE3 NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_000 NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP 130 140 150 160 170 180 190 200 pF1KE3 PPVPNPDYEPIRKGQRDLYSGLNQRRI ::::::::::::::::::::::::::: NP_000 PPVPNPDYEPIRKGQRDLYSGLNQRRI 190 200 207 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 12:32:28 2016 done: Sun Nov 6 12:32:29 2016 Total Scan time: 6.260 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]