Result of FASTA (ccds) for pFN21AE6542
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6542, 98 aa
  1>>>pF1KE6542 98 - 98 aa - 98 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.2282+/-0.000619; mu= 9.4516+/- 0.037
 mean_var=57.8649+/-11.386, 0's: 0 Z-trim(110.7): 10  B-trim: 0 in 0/51
 Lambda= 0.168604
 statistics sampled from 11815 (11821) to 11815 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.763), E-opt: 0.2 (0.363), width:  16
 Scan time:  1.410

The best scores are:                                      opt bits E(32554)
CCDS31020.1 SPATA45 gene_id:149643|Hs108|chr1      (  98)  647 164.8 7.8e-42


>>CCDS31020.1 SPATA45 gene_id:149643|Hs108|chr1           (98 aa)
 initn: 647 init1: 647 opt: 647  Z-score: 864.5  bits: 164.8 E(32554): 7.8e-42
Smith-Waterman score: 647; 100.0% identity (100.0% similar) in 98 aa overlap (1-98:1-98)

               10        20        30        40        50        60
pF1KE6 MASINRTIEIMKKHGVSKQHLLEEINKKRESNCLVERSNQVSLLRVQKRHFPDAYQSFTD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS31 MASINRTIEIMKKHGVSKQHLLEEINKKRESNCLVERSNQVSLLRVQKRHFPDAYQSFTD
               10        20        30        40        50        60

               70        80        90        
pF1KE6 TTTKEPVPNSGRSSWIKLSLLAHMERKHFPPKNNAIFG
       ::::::::::::::::::::::::::::::::::::::
CCDS31 TTTKEPVPNSGRSSWIKLSLLAHMERKHFPPKNNAIFG
               70        80        90        




98 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:15:33 2016 done: Tue Nov  8 14:15:33 2016
 Total Scan time:  1.410 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com