FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6510, 78 aa 1>>>pF1KE6510 78 - 78 aa - 78 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.1073+/-0.000226; mu= 4.8828+/- 0.014 mean_var=80.4862+/-15.850, 0's: 0 Z-trim(125.0): 2 B-trim: 307 in 1/54 Lambda= 0.142960 statistics sampled from 47662 (47664) to 47662 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.881), E-opt: 0.2 (0.559), width: 16 Scan time: 4.290 The best scores are: opt bits E(85289) NP_001096046 (OMIM: 300944) putative chondrosarcom ( 78) 551 121.4 1.5e-28 NP_705611 (OMIM: 300944) putative chondrosarcoma-a ( 78) 551 121.4 1.5e-28 >>NP_001096046 (OMIM: 300944) putative chondrosarcoma-as (78 aa) initn: 551 init1: 551 opt: 551 Z-score: 633.6 bits: 121.4 E(85289): 1.5e-28 Smith-Waterman score: 551; 100.0% identity (100.0% similar) in 78 aa overlap (1-78:1-78) 10 20 30 40 50 60 pF1KE6 MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ 10 20 30 40 50 60 70 pF1KE6 PRREKGPVKEVPGTKGSP :::::::::::::::::: NP_001 PRREKGPVKEVPGTKGSP 70 >>NP_705611 (OMIM: 300944) putative chondrosarcoma-assoc (78 aa) initn: 551 init1: 551 opt: 551 Z-score: 633.6 bits: 121.4 E(85289): 1.5e-28 Smith-Waterman score: 551; 100.0% identity (100.0% similar) in 78 aa overlap (1-78:1-78) 10 20 30 40 50 60 pF1KE6 MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_705 MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ 10 20 30 40 50 60 70 pF1KE6 PRREKGPVKEVPGTKGSP :::::::::::::::::: NP_705 PRREKGPVKEVPGTKGSP 70 78 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 13:57:36 2016 done: Tue Nov 8 13:57:36 2016 Total Scan time: 4.290 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]