FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6510, 78 aa 1>>>pF1KE6510 78 - 78 aa - 78 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.6726+/-0.00048; mu= 7.4920+/- 0.029 mean_var=81.8872+/-16.022, 0's: 0 Z-trim(117.5): 1 B-trim: 0 in 0/52 Lambda= 0.141731 statistics sampled from 18224 (18225) to 18224 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.886), E-opt: 0.2 (0.56), width: 16 Scan time: 1.120 The best scores are: opt bits E(32554) CCDS76047.1 CSAG1 gene_id:158511|Hs108|chrX ( 78) 551 120.3 1.2e-28 >>CCDS76047.1 CSAG1 gene_id:158511|Hs108|chrX (78 aa) initn: 551 init1: 551 opt: 551 Z-score: 627.8 bits: 120.3 E(32554): 1.2e-28 Smith-Waterman score: 551; 100.0% identity (100.0% similar) in 78 aa overlap (1-78:1-78) 10 20 30 40 50 60 pF1KE6 MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS76 MSATTACWPAFTVLGEARGDQVDWSRLYRDTGLVKMSRKPRASSPFSNNHPSTPKRFPRQ 10 20 30 40 50 60 70 pF1KE6 PRREKGPVKEVPGTKGSP :::::::::::::::::: CCDS76 PRREKGPVKEVPGTKGSP 70 78 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 13:57:35 2016 done: Tue Nov 8 13:57:35 2016 Total Scan time: 1.120 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]