FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6535, 70 aa 1>>>pF1KE6535 70 - 70 aa - 70 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3953+/-0.000537; mu= 10.6339+/- 0.032 mean_var=42.5178+/- 8.798, 0's: 0 Z-trim(111.6): 6 B-trim: 772 in 1/50 Lambda= 0.196693 statistics sampled from 12468 (12473) to 12468 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.786), E-opt: 0.2 (0.383), width: 16 Scan time: 1.260 The best scores are: opt bits E(32554) CCDS14590.1 NDUFA1 gene_id:4694|Hs108|chrX ( 70) 486 144.1 6.8e-36 >>CCDS14590.1 NDUFA1 gene_id:4694|Hs108|chrX (70 aa) initn: 486 init1: 486 opt: 486 Z-score: 757.9 bits: 144.1 E(32554): 6.8e-36 Smith-Waterman score: 486; 100.0% identity (100.0% similar) in 70 aa overlap (1-70:1-70) 10 20 30 40 50 60 pF1KE6 MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS14 MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRY 10 20 30 40 50 60 70 pF1KE6 YVSKGLENID :::::::::: CCDS14 YVSKGLENID 70 70 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:11:44 2016 done: Tue Nov 8 14:11:44 2016 Total Scan time: 1.260 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]