FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6538, 88 aa 1>>>pF1KE6538 88 - 88 aa - 88 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.5105+/-0.000228; mu= 4.8346+/- 0.014 mean_var=99.8259+/-19.497, 0's: 0 Z-trim(125.2): 1 B-trim: 187 in 1/57 Lambda= 0.128367 statistics sampled from 48456 (48457) to 48456 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.878), E-opt: 0.2 (0.568), width: 16 Scan time: 3.400 The best scores are: opt bits E(85289) NP_055147 (OMIM: 300066,300226) small muscular pro ( 88) 594 118.3 1.6e-27 >>NP_055147 (OMIM: 300066,300226) small muscular protein (88 aa) initn: 594 init1: 594 opt: 594 Z-score: 614.9 bits: 118.3 E(85289): 1.6e-27 Smith-Waterman score: 594; 100.0% identity (100.0% similar) in 88 aa overlap (1-88:1-88) 10 20 30 40 50 60 pF1KE6 MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_055 MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGA 10 20 30 40 50 60 70 80 pF1KE6 KKLPGPAVNLSEIQNIKSELKYVPKAEQ :::::::::::::::::::::::::::: NP_055 KKLPGPAVNLSEIQNIKSELKYVPKAEQ 70 80 88 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:13:27 2016 done: Tue Nov 8 14:13:28 2016 Total Scan time: 3.400 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]