Result of FASTA (omim) for pFN21AE6538
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6538, 88 aa
  1>>>pF1KE6538 88 - 88 aa - 88 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.5105+/-0.000228; mu= 4.8346+/- 0.014
 mean_var=99.8259+/-19.497, 0's: 0 Z-trim(125.2): 1  B-trim: 187 in 1/57
 Lambda= 0.128367
 statistics sampled from 48456 (48457) to 48456 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.878), E-opt: 0.2 (0.568), width:  16
 Scan time:  3.400

The best scores are:                                      opt bits E(85289)
NP_055147 (OMIM: 300066,300226) small muscular pro (  88)  594 118.3 1.6e-27


>>NP_055147 (OMIM: 300066,300226) small muscular protein  (88 aa)
 initn: 594 init1: 594 opt: 594  Z-score: 614.9  bits: 118.3 E(85289): 1.6e-27
Smith-Waterman score: 594; 100.0% identity (100.0% similar) in 88 aa overlap (1-88:1-88)

               10        20        30        40        50        60
pF1KE6 MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGA
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_055 MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGA
               10        20        30        40        50        60

               70        80        
pF1KE6 KKLPGPAVNLSEIQNIKSELKYVPKAEQ
       ::::::::::::::::::::::::::::
NP_055 KKLPGPAVNLSEIQNIKSELKYVPKAEQ
               70        80        




88 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:13:27 2016 done: Tue Nov  8 14:13:28 2016
 Total Scan time:  3.400 Total Display time: -0.020

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com