FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6538, 88 aa
  1>>>pF1KE6538 88 - 88 aa - 88 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 6.1669+/-0.000534; mu= 7.0719+/- 0.033
 mean_var=102.3538+/-19.813, 0's: 0 Z-trim(117.6): 1  B-trim: 0 in 0/53
 Lambda= 0.126772
 statistics sampled from 18413 (18414) to 18413 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.872), E-opt: 0.2 (0.566), width:  16
 Scan time:  1.080

The best scores are:                                      opt bits E(32554)
CCDS14200.1 SMPX gene_id:23676|Hs108|chrX          (  88)  594 116.9 1.7e-27


>>CCDS14200.1 SMPX gene_id:23676|Hs108|chrX               (88 aa)
 initn: 594 init1: 594 opt: 594  Z-score: 607.3  bits: 116.9 E(32554): 1.7e-27
Smith-Waterman score: 594; 100.0% identity (100.0% similar) in 88 aa overlap (1-88:1-88)

               10        20        30        40        50        60
pF1KE6 MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGA
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS14 MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGA
               10        20        30        40        50        60

               70        80        
pF1KE6 KKLPGPAVNLSEIQNIKSELKYVPKAEQ
       ::::::::::::::::::::::::::::
CCDS14 KKLPGPAVNLSEIQNIKSELKYVPKAEQ
               70        80        




88 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:13:27 2016 done: Tue Nov  8 14:13:27 2016
 Total Scan time:  1.080 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]