FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6177, 108 aa 1>>>pF1KE6177 108 - 108 aa - 108 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.4155+/-0.000697; mu= 9.1865+/- 0.042 mean_var=59.9592+/-11.930, 0's: 0 Z-trim(109.0): 14 B-trim: 0 in 0/51 Lambda= 0.165633 statistics sampled from 10570 (10577) to 10570 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.726), E-opt: 0.2 (0.325), width: 16 Scan time: 1.280 The best scores are: opt bits E(32554) CCDS13574.1 ATP5J gene_id:522|Hs108|chr21 ( 108) 696 174.0 1.6e-44 CCDS46637.1 ATP5J gene_id:522|Hs108|chr21 ( 116) 696 174.0 1.7e-44 >>CCDS13574.1 ATP5J gene_id:522|Hs108|chr21 (108 aa) initn: 696 init1: 696 opt: 696 Z-score: 913.0 bits: 174.0 E(32554): 1.6e-44 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:1-108) 10 20 30 40 50 60 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS13 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP 10 20 30 40 50 60 70 80 90 100 pF1KE6 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::: CCDS13 VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 >>CCDS46637.1 ATP5J gene_id:522|Hs108|chr21 (116 aa) initn: 696 init1: 696 opt: 696 Z-score: 912.5 bits: 174.0 E(32554): 1.7e-44 Smith-Waterman score: 696; 100.0% identity (100.0% similar) in 108 aa overlap (1-108:9-116) 10 20 30 40 50 pF1KE6 MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKS :::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS46 MHCDGGISMILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKS 10 20 30 40 50 60 60 70 80 90 100 pF1KE6 KRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA :::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS46 KRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA 70 80 90 100 110 108 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 10:06:42 2016 done: Tue Nov 8 10:06:43 2016 Total Scan time: 1.280 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]