FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3004, 76 aa 1>>>pF1KE3004 76 - 76 aa - 76 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0555+/-0.000519; mu= 9.0327+/- 0.032 mean_var=57.7636+/-11.382, 0's: 0 Z-trim(113.0): 11 B-trim: 135 in 1/49 Lambda= 0.168751 statistics sampled from 13720 (13727) to 13720 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.813), E-opt: 0.2 (0.422), width: 16 Scan time: 1.400 The best scores are: opt bits E(32554) CCDS13334.1 PKIG gene_id:11142|Hs108|chr20 ( 76) 493 127.1 1.1e-30 >>CCDS13334.1 PKIG gene_id:11142|Hs108|chr20 (76 aa) initn: 493 init1: 493 opt: 493 Z-score: 664.7 bits: 127.1 E(32554): 1.1e-30 Smith-Waterman score: 493; 100.0% identity (100.0% similar) in 76 aa overlap (1-76:1-76) 10 20 30 40 50 60 pF1KE3 MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPD :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS13 MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGELALEGAEGQVEGSAPD 10 20 30 40 50 60 70 pF1KE3 KEAGNQPQSSDGTTSS :::::::::::::::: CCDS13 KEAGNQPQSSDGTTSS 70 76 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 13:03:58 2016 done: Sun Nov 6 13:03:58 2016 Total Scan time: 1.400 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]