Result of FASTA (ccds) for pFN21AE1202
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE1202, 111 aa
  1>>>pF1KE1202 111 - 111 aa - 111 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8288+/-0.000691; mu= 12.7254+/- 0.042
 mean_var=63.0419+/-11.900, 0's: 0 Z-trim(110.0): 24  B-trim: 65 in 1/52
 Lambda= 0.161532
 statistics sampled from 11276 (11297) to 11276 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.732), E-opt: 0.2 (0.347), width:  16
 Scan time:  1.510

The best scores are:                                      opt bits E(32554)
CCDS12990.1 DEFB126 gene_id:81623|Hs108|chr20      ( 111)  755 183.6 2.1e-47


>>CCDS12990.1 DEFB126 gene_id:81623|Hs108|chr20           (111 aa)
 initn: 755 init1: 755 opt: 755  Z-score: 964.5  bits: 183.6 E(32554): 2.1e-47
Smith-Waterman score: 755; 100.0% identity (100.0% similar) in 111 aa overlap (1-111:1-111)

               10        20        30        40        50        60
pF1KE1 MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCV
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCV
               10        20        30        40        50        60

               70        80        90       100       110 
pF1KE1 PADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG
       :::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS12 PADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG
               70        80        90       100       110 




111 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Sun Nov  6 13:11:17 2016 done: Sun Nov  6 13:11:17 2016
 Total Scan time:  1.510 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com