FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5269, 198 aa 1>>>pF1KE5269 198 - 198 aa - 198 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0668+/-0.000311; mu= 15.3971+/- 0.019 mean_var=70.7554+/-14.274, 0's: 0 Z-trim(117.0): 3 B-trim: 809 in 1/53 Lambda= 0.152474 statistics sampled from 28595 (28596) to 28595 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.72), E-opt: 0.2 (0.335), width: 16 Scan time: 5.180 The best scores are: opt bits E(85289) NP_002940 (OMIM: 602375) 39S ribosomal protein L12 ( 198) 1266 286.9 1.5e-77 >>NP_002940 (OMIM: 602375) 39S ribosomal protein L12, mi (198 aa) initn: 1266 init1: 1266 opt: 1266 Z-score: 1513.4 bits: 286.9 E(85289): 1.5e-77 Smith-Waterman score: 1266; 100.0% identity (100.0% similar) in 198 aa overlap (1-198:1-198) 10 20 30 40 50 60 pF1KE5 MLPAAARPLWGPCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 MLPAAARPLWGPCLGLRAAAFRLARRQVPCVCAVRHMRSSGHQRCEALAGAPLDNAPKEY 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 PPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEED :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 PPKIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEED 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE5 IPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 IPIAKERTHFTVRLTEAKPVDKVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAE 130 140 150 160 170 180 190 pF1KE5 AEKIKAALEAVGGTVVLE :::::::::::::::::: NP_002 AEKIKAALEAVGGTVVLE 190 198 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 23:18:00 2016 done: Mon Nov 7 23:18:01 2016 Total Scan time: 5.180 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]