Result of FASTA (omim) for pFN21AE3012
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3012, 101 aa
  1>>>pF1KE3012     101 - 101 aa - 101 aa
Library: /omim/omim.rfq.tfa
  64092750 residues in 91774 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.8146+/-0.00022; mu= 8.7076+/- 0.014
 mean_var=88.0925+/-17.781, 0's: 0 Z-trim(125.6): 1  B-trim: 831 in 1/51
 Lambda= 0.136649
 statistics sampled from 51573 (51574) to 51573 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.878), E-opt: 0.2 (0.562), width:  16
 Scan time:  2.860

The best scores are:                                      opt bits E(91774)
NP_000796 (OMIM: 137250) gastrin preproprotein [Ho ( 101)  723 150.5 4.6e-37


>>NP_000796 (OMIM: 137250) gastrin preproprotein [Homo s  (101 aa)
 initn: 723 init1: 723 opt: 723  Z-score: 786.9  bits: 150.5 E(91774): 4.6e-37
Smith-Waterman score: 723; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101)

               10        20        30        40        50        60
pF1KE3 MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_000 MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
               10        20        30        40        50        60

               70        80        90       100 
pF1KE3 GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
       :::::::::::::::::::::::::::::::::::::::::
NP_000 GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
               70        80        90       100 




101 residues in 1 query   sequences
64092750 residues in 91774 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Jul 16 16:05:48 2019 done: Tue Jul 16 16:05:49 2019
 Total Scan time:  2.860 Total Display time:  0.010

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com