Result of FASTA (ccds) for pFN21AE3012
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE3012, 101 aa
  1>>>pF1KE3012     101 - 101 aa - 101 aa
Library: human.CCDS.faa
  18921897 residues in 33420 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 5.6700+/-0.00048; mu= 9.7102+/- 0.029
 mean_var=88.2945+/-17.385, 0's: 0 Z-trim(117.8): 1  B-trim: 91 in 1/51
 Lambda= 0.136492
 statistics sampled from 18909 (18910) to 18909 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.882), E-opt: 0.2 (0.566), width:  16
 Scan time:  0.760

The best scores are:                                      opt bits E(33420)
CCDS11404.1 GAST gene_id:2520|Hs109|chr17          ( 101)  723 150.3   2e-37


>>CCDS11404.1 GAST gene_id:2520|Hs109|chr17               (101 aa)
 initn: 723 init1: 723 opt: 723  Z-score: 785.7  bits: 150.3 E(33420): 2e-37
Smith-Waterman score: 723; 100.0% identity (100.0% similar) in 101 aa overlap (1-101:1-101)

               10        20        30        40        50        60
pF1KE3 MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS11 MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
               10        20        30        40        50        60

               70        80        90       100 
pF1KE3 GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
       :::::::::::::::::::::::::::::::::::::::::
CCDS11 GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
               70        80        90       100 




101 residues in 1 query   sequences
18921897 residues in 33420 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Jul 16 16:05:48 2019 done: Tue Jul 16 16:05:48 2019
 Total Scan time:  0.760 Total Display time:  0.000

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com