FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2175, 124 aa 1>>>pF1KE2175 124 - 124 aa - 124 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.9211+/-0.000722; mu= 7.0487+/- 0.043 mean_var=83.6253+/-16.755, 0's: 0 Z-trim(110.3): 106 B-trim: 167 in 2/49 Lambda= 0.140251 statistics sampled from 11386 (11526) to 11386 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.749), E-opt: 0.2 (0.354), width: 16 Scan time: 1.390 The best scores are: opt bits E(32554) CCDS11032.1 TAX1BP3 gene_id:30851|Hs108|chr17 ( 124) 804 171.7 1e-43 CCDS73940.1 TAX1BP3 gene_id:30851|Hs108|chr17 ( 98) 355 80.8 1.9e-16 >>CCDS11032.1 TAX1BP3 gene_id:30851|Hs108|chr17 (124 aa) initn: 804 init1: 804 opt: 804 Z-score: 898.4 bits: 171.7 E(32554): 1e-43 Smith-Waterman score: 804; 100.0% identity (100.0% similar) in 124 aa overlap (1-124:1-124) 10 20 30 40 50 60 pF1KE2 MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE2 SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS11 SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ 70 80 90 100 110 120 pF1KE2 SMLS :::: CCDS11 SMLS >>CCDS73940.1 TAX1BP3 gene_id:30851|Hs108|chr17 (98 aa) initn: 355 init1: 355 opt: 355 Z-score: 408.9 bits: 80.8 E(32554): 1.9e-16 Smith-Waterman score: 575; 79.0% identity (79.0% similar) in 124 aa overlap (1-124:1-98) 10 20 30 40 50 60 pF1KE2 MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV ::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS73 MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDK------- 10 20 30 40 50 70 80 90 100 110 120 pF1KE2 SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ ::::::::::::::::::::::::::::::::::::::::: CCDS73 -------------------VNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ 60 70 80 90 pF1KE2 SMLS :::: CCDS73 SMLS 124 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 14:00:49 2016 done: Sun Nov 6 14:00:49 2016 Total Scan time: 1.390 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]