Result of FASTA (ccds) for pFN21AE5139
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE5139, 115 aa
  1>>>pF1KE5139     115 - 115 aa - 115 aa
Library: human.CCDS.faa
  18921897 residues in 33420 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8035+/-0.000662; mu= 13.3622+/- 0.040
 mean_var=77.7838+/-14.669, 0's: 0 Z-trim(111.8): 64  B-trim: 7 in 1/51
 Lambda= 0.145422
 statistics sampled from 12761 (12830) to 12761 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.767), E-opt: 0.2 (0.384), width:  16
 Scan time:  0.890

The best scores are:                                      opt bits E(33420)
CCDS10288.1 NRG4 gene_id:145957|Hs109|chr15        ( 115)  801 176.4 3.6e-45


>>CCDS10288.1 NRG4 gene_id:145957|Hs109|chr15             (115 aa)
 initn: 801 init1: 801 opt: 801  Z-score: 924.7  bits: 176.4 E(33420): 3.6e-45
Smith-Waterman score: 801; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115)

               10        20        30        40        50        60
pF1KE5 MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSN
               10        20        30        40        50        60

               70        80        90       100       110     
pF1KE5 LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS10 LFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
               70        80        90       100       110     




115 residues in 1 query   sequences
18921897 residues in 33420 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Thu Oct 24 21:45:29 2019 done: Thu Oct 24 21:45:30 2019
 Total Scan time:  0.890 Total Display time:  0.000

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com