Result of FASTA (omim) for pFN21AE6534
FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6534, 64 aa
  1>>>pF1KE6534 64 - 64 aa - 64 aa
Library: /omim/omim.rfq.tfa
  60827320 residues in 85289 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.6988+/-0.000234; mu= 9.2097+/- 0.015
 mean_var=48.0664+/- 9.535, 0's: 0 Z-trim(121.8): 1  B-trim: 117 in 1/54
 Lambda= 0.184992
 statistics sampled from 38862 (38863) to 38862 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.846), E-opt: 0.2 (0.456), width:  16
 Scan time:  2.200

The best scores are:                                      opt bits E(85289)
NP_061118 (OMIM: 224230,606471) H/ACA ribonucleopr (  64)  444 124.8 9.5e-30


>>NP_061118 (OMIM: 224230,606471) H/ACA ribonucleoprotei  (64 aa)
 initn: 444 init1: 444 opt: 444  Z-score: 655.1  bits: 124.8 E(85289): 9.5e-30
Smith-Waterman score: 444; 100.0% identity (100.0% similar) in 64 aa overlap (1-64:1-64)

               10        20        30        40        50        60
pF1KE6 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
NP_061 MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQP
               10        20        30        40        50        60

           
pF1KE6 RPVL
       ::::
NP_061 RPVL
           




64 residues in 1 query   sequences
60827320 residues in 85289 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 14:10:54 2016 done: Tue Nov  8 14:10:55 2016
 Total Scan time:  2.200 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]
Inquiries or Suggestions ?
Send a message to flexiclone AT kazusagt.com