FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2287, 71 aa 1>>>pF1KE2287 71 - 71 aa - 71 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.1714+/-0.000346; mu= 12.0096+/- 0.021 mean_var=44.9932+/- 9.721, 0's: 0 Z-trim(113.3): 7 B-trim: 869 in 1/49 Lambda= 0.191206 statistics sampled from 22514 (22518) to 22514 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.657), E-opt: 0.2 (0.264), width: 16 Scan time: 2.730 The best scores are: opt bits E(85289) NP_612145 (OMIM: 613540) serine palmitoyltransfera ( 71) 481 139.5 4.3e-34 NP_001307608 (OMIM: 610412) serine palmitoyltransf ( 76) 225 68.9 8.2e-13 NP_001035189 (OMIM: 610412) serine palmitoyltransf ( 76) 225 68.9 8.2e-13 >>NP_612145 (OMIM: 613540) serine palmitoyltransferase s (71 aa) initn: 481 init1: 481 opt: 481 Z-score: 733.1 bits: 139.5 E(85289): 4.3e-34 Smith-Waterman score: 481; 100.0% identity (100.0% similar) in 71 aa overlap (1-71:1-71) 10 20 30 40 50 60 pF1KE2 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_612 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI 10 20 30 40 50 60 70 pF1KE2 MAILHYFEIVQ ::::::::::: NP_612 MAILHYFEIVQ 70 >>NP_001307608 (OMIM: 610412) serine palmitoyltransferas (76 aa) initn: 220 init1: 220 opt: 225 Z-score: 351.0 bits: 68.9 E(85289): 8.2e-13 Smith-Waterman score: 225; 45.3% identity (79.7% similar) in 64 aa overlap (4-67:1-64) 10 20 30 40 50 60 pF1KE2 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI : : :. . .::.:::: ... .::::::..::..:..:..:..::.:::.: :: NP_001 MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHI 10 20 30 40 50 70 pF1KE2 MAILHYFEIVQ ..: NP_001 RLAWEFFSKICGYHSTISN 60 70 >>NP_001035189 (OMIM: 610412) serine palmitoyltransferas (76 aa) initn: 220 init1: 220 opt: 225 Z-score: 351.0 bits: 68.9 E(85289): 8.2e-13 Smith-Waterman score: 225; 45.3% identity (79.7% similar) in 64 aa overlap (4-67:1-64) 10 20 30 40 50 60 pF1KE2 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI : : :. . .::.:::: ... .::::::..::..:..:..:..::.:::.: :: NP_001 MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHI 10 20 30 40 50 70 pF1KE2 MAILHYFEIVQ ..: NP_001 RLAWEFFSKICGYHSTISN 60 70 71 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 14:27:27 2016 done: Sun Nov 6 14:27:28 2016 Total Scan time: 2.730 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]