FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2287, 71 aa 1>>>pF1KE2287 71 - 71 aa - 71 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.3079+/-0.000704; mu= 11.0814+/- 0.042 mean_var=44.5546+/- 9.266, 0's: 0 Z-trim(107.0): 16 B-trim: 0 in 0/45 Lambda= 0.192145 statistics sampled from 9310 (9313) to 9310 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.68), E-opt: 0.2 (0.286), width: 16 Scan time: 1.110 The best scores are: opt bits E(32554) CCDS9647.2 SPTSSA gene_id:171546|Hs108|chr14 ( 71) 481 140.1 1.1e-34 CCDS33887.1 SPTSSB gene_id:165679|Hs108|chr3 ( 76) 225 69.2 2.7e-13 >>CCDS9647.2 SPTSSA gene_id:171546|Hs108|chr14 (71 aa) initn: 481 init1: 481 opt: 481 Z-score: 736.3 bits: 140.1 E(32554): 1.1e-34 Smith-Waterman score: 481; 100.0% identity (100.0% similar) in 71 aa overlap (1-71:1-71) 10 20 30 40 50 60 pF1KE2 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS96 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI 10 20 30 40 50 60 70 pF1KE2 MAILHYFEIVQ ::::::::::: CCDS96 MAILHYFEIVQ 70 >>CCDS33887.1 SPTSSB gene_id:165679|Hs108|chr3 (76 aa) initn: 220 init1: 220 opt: 225 Z-score: 352.3 bits: 69.2 E(32554): 2.7e-13 Smith-Waterman score: 225; 45.3% identity (79.7% similar) in 64 aa overlap (4-67:1-64) 10 20 30 40 50 60 pF1KE2 MAGMALARAWKQMSWFYYQYLLVTALYMLEPWERTVFNSMLVSIVGMALYTGYVFMPQHI : : :. . .::.:::: ... .::::::..::..:..:..:..::.:::.: :: CCDS33 MDLRRVKEYFSWLYYQYQIISCCAVLEPWERSMFNTILLTIIAMVVYTAYVFIPIHI 10 20 30 40 50 70 pF1KE2 MAILHYFEIVQ ..: CCDS33 RLAWEFFSKICGYHSTISN 60 70 71 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 14:27:27 2016 done: Sun Nov 6 14:27:27 2016 Total Scan time: 1.110 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]