FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3006, 85 aa 1>>>pF1KE3006 85 - 85 aa - 85 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2447+/-0.000622; mu= 7.5380+/- 0.037 mean_var=48.6620+/- 9.460, 0's: 0 Z-trim(109.2): 11 B-trim: 0 in 0/49 Lambda= 0.183857 statistics sampled from 10723 (10726) to 10723 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.741), E-opt: 0.2 (0.329), width: 16 Scan time: 1.330 The best scores are: opt bits E(32554) CCDS9366.1 UFM1 gene_id:51569|Hs108|chr13 ( 85) 543 151.1 7.7e-38 CCDS66533.1 UFM1 gene_id:51569|Hs108|chr13 ( 103) 417 117.7 1.1e-27 >>CCDS9366.1 UFM1 gene_id:51569|Hs108|chr13 (85 aa) initn: 543 init1: 543 opt: 543 Z-score: 792.9 bits: 151.1 E(32554): 7.7e-38 Smith-Waterman score: 543; 100.0% identity (100.0% similar) in 85 aa overlap (1-85:1-85) 10 20 30 40 50 60 pF1KE3 MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS93 MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINPA 10 20 30 40 50 60 70 80 pF1KE3 QTAGNVFLKHGSELRIIPRDRVGSC ::::::::::::::::::::::::: CCDS93 QTAGNVFLKHGSELRIIPRDRVGSC 70 80 >>CCDS66533.1 UFM1 gene_id:51569|Hs108|chr13 (103 aa) initn: 417 init1: 417 opt: 417 Z-score: 610.8 bits: 117.7 E(32554): 1.1e-27 Smith-Waterman score: 417; 100.0% identity (100.0% similar) in 65 aa overlap (21-85:39-103) 10 20 30 40 50 pF1KE3 MSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAII :::::::::::::::::::::::::::::: CCDS66 TPRSLHLFTSSTFLARALPGAFPTGACEERLSVPESTPFTAVLKFAAEEFKVPAATSAII 10 20 30 40 50 60 60 70 80 pF1KE3 TNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC ::::::::::::::::::::::::::::::::::: CCDS66 TNDGIGINPAQTAGNVFLKHGSELRIIPRDRVGSC 70 80 90 100 85 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 14:36:49 2016 done: Sun Nov 6 14:36:50 2016 Total Scan time: 1.330 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]