FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5326, 278 aa 1>>>pF1KE5326 278 - 278 aa - 278 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.0403+/-0.000912; mu= 11.9447+/- 0.055 mean_var=81.0607+/-15.765, 0's: 0 Z-trim(106.2): 19 B-trim: 0 in 0/51 Lambda= 0.142452 statistics sampled from 8838 (8844) to 8838 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.641), E-opt: 0.2 (0.272), width: 16 Scan time: 2.240 The best scores are: opt bits E(32554) CCDS9322.1 MTIF3 gene_id:219402|Hs108|chr13 ( 278) 1777 374.7 4e-104 >>CCDS9322.1 MTIF3 gene_id:219402|Hs108|chr13 (278 aa) initn: 1777 init1: 1777 opt: 1777 Z-score: 1982.8 bits: 374.7 E(32554): 4e-104 Smith-Waterman score: 1777; 99.3% identity (99.6% similar) in 278 aa overlap (1-278:1-278) 10 20 30 40 50 60 pF1KE5 MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAED :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS93 MAALFLKRLTLQTVKSENSCIRCFGKHILQKTAPAQLSPIASAPRLSFLIHAKAFSTAED 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 TQNEGKKIKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRN ::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS93 TQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRN 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE5 TSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS93 TSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQ 130 140 150 160 170 180 190 200 210 220 230 240 pF1KE5 QWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS93 QWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVL 190 200 210 220 230 240 250 260 270 pF1KE5 RALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ ::.::::::::::::::::::::::::::::::::::: CCDS93 RAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ 250 260 270 278 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 23:48:27 2016 done: Mon Nov 7 23:48:28 2016 Total Scan time: 2.240 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]