FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1884, 410 aa 1>>>pF1KE1884 410 - 410 aa - 410 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.2163+/-0.000897; mu= 10.1895+/- 0.055 mean_var=140.8290+/-28.019, 0's: 0 Z-trim(111.4): 5 B-trim: 167 in 2/54 Lambda= 0.108076 statistics sampled from 12327 (12328) to 12327 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.731), E-opt: 0.2 (0.379), width: 16 Scan time: 3.130 The best scores are: opt bits E(32554) CCDS9095.1 TDG gene_id:6996|Hs108|chr12 ( 410) 2774 443.8 1.4e-124 >>CCDS9095.1 TDG gene_id:6996|Hs108|chr12 (410 aa) initn: 2774 init1: 2774 opt: 2774 Z-score: 2349.9 bits: 443.8 E(32554): 1.4e-124 Smith-Waterman score: 2774; 100.0% identity (100.0% similar) in 410 aa overlap (1-410:1-410) 10 20 30 40 50 60 pF1KE1 MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS90 MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKG 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 RKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS90 RKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELL 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE1 TKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHT :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS90 TKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHT 130 140 150 160 170 180 190 200 210 220 230 240 pF1KE1 LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS90 LPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSK 190 200 210 220 230 240 250 260 270 280 290 300 pF1KE1 EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS90 EVFGVKVKNLEFGLQPHKIPDTETLCYVMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK 250 260 270 280 290 300 310 320 330 340 350 360 pF1KE1 GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSS :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS90 GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSS 310 320 330 340 350 360 370 380 390 400 410 pF1KE1 NGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA :::::::::::::::::::::::::::::::::::::::::::::::::: CCDS90 NGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA 370 380 390 400 410 410 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 14:43:12 2016 done: Sun Nov 6 14:43:13 2016 Total Scan time: 3.130 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]