FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6537, 78 aa 1>>>pF1KE6537 78 - 78 aa - 78 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.4479+/-0.000241; mu= 4.9440+/- 0.015 mean_var=149.2355+/-29.411, 0's: 0 Z-trim(126.4): 2 B-trim: 33 in 1/55 Lambda= 0.104988 statistics sampled from 52420 (52423) to 52420 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.895), E-opt: 0.2 (0.615), width: 16 Scan time: 3.260 The best scores are: opt bits E(85289) NP_001119653 (OMIM: 602350) neurogranin [Homo sapi ( 78) 560 93.9 2.8e-20 NP_006167 (OMIM: 602350) neurogranin [Homo sapiens ( 78) 560 93.9 2.8e-20 >>NP_001119653 (OMIM: 602350) neurogranin [Homo sapiens] (78 aa) initn: 560 init1: 560 opt: 560 Z-score: 485.2 bits: 93.9 E(85289): 2.8e-20 Smith-Waterman score: 560; 100.0% identity (100.0% similar) in 78 aa overlap (1-78:1-78) 10 20 30 40 50 60 pF1KE6 MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG 10 20 30 40 50 60 70 pF1KE6 PGGAGVARGGAGGGPSGD :::::::::::::::::: NP_001 PGGAGVARGGAGGGPSGD 70 >>NP_006167 (OMIM: 602350) neurogranin [Homo sapiens] (78 aa) initn: 560 init1: 560 opt: 560 Z-score: 485.2 bits: 93.9 E(85289): 2.8e-20 Smith-Waterman score: 560; 100.0% identity (100.0% similar) in 78 aa overlap (1-78:1-78) 10 20 30 40 50 60 pF1KE6 MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_006 MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG 10 20 30 40 50 60 70 pF1KE6 PGGAGVARGGAGGGPSGD :::::::::::::::::: NP_006 PGGAGVARGGAGGGPSGD 70 78 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:13:00 2016 done: Tue Nov 8 14:13:00 2016 Total Scan time: 3.260 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]