FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6537, 78 aa 1>>>pF1KE6537 78 - 78 aa - 78 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.1431+/-0.000563; mu= 7.4305+/- 0.034 mean_var=147.3242+/-29.438, 0's: 0 Z-trim(119.2): 2 B-trim: 2 in 1/51 Lambda= 0.105666 statistics sampled from 20302 (20304) to 20302 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.9), E-opt: 0.2 (0.624), width: 16 Scan time: 1.320 The best scores are: opt bits E(32554) CCDS8451.1 NRGN gene_id:4900|Hs108|chr11 ( 78) 560 94.2 8.5e-21 >>CCDS8451.1 NRGN gene_id:4900|Hs108|chr11 (78 aa) initn: 560 init1: 560 opt: 560 Z-score: 486.9 bits: 94.2 E(32554): 8.5e-21 Smith-Waterman score: 560; 100.0% identity (100.0% similar) in 78 aa overlap (1-78:1-78) 10 20 30 40 50 60 pF1KE6 MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS84 MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGG 10 20 30 40 50 60 70 pF1KE6 PGGAGVARGGAGGGPSGD :::::::::::::::::: CCDS84 PGGAGVARGGAGGGPSGD 70 78 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:12:59 2016 done: Tue Nov 8 14:13:00 2016 Total Scan time: 1.320 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]