FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3027, 151 aa 1>>>pF1KE3027 151 - 151 aa - 151 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.6558+/-0.000709; mu= 6.2484+/- 0.043 mean_var=105.2822+/-20.276, 0's: 0 Z-trim(112.6): 12 B-trim: 0 in 0/53 Lambda= 0.124996 statistics sampled from 13367 (13378) to 13367 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.77), E-opt: 0.2 (0.411), width: 16 Scan time: 1.800 The best scores are: opt bits E(32554) CCDS8450.1 SPA17 gene_id:53340|Hs108|chr11 ( 151) 981 186.3 5.9e-48 >>CCDS8450.1 SPA17 gene_id:53340|Hs108|chr11 (151 aa) initn: 981 init1: 981 opt: 981 Z-score: 974.4 bits: 186.3 E(32554): 5.9e-48 Smith-Waterman score: 981; 100.0% identity (100.0% similar) in 151 aa overlap (1-151:1-151) 10 20 30 40 50 60 pF1KE3 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS84 MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEW 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 GSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS84 GSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVK 70 80 90 100 110 120 130 140 150 pF1KE3 IQAAFRGHIAREEAKKMKTNSLQNEEKEENK ::::::::::::::::::::::::::::::: CCDS84 IQAAFRGHIAREEAKKMKTNSLQNEEKEENK 130 140 150 151 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 14:58:25 2016 done: Sun Nov 6 14:58:25 2016 Total Scan time: 1.800 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]