FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5171, 161 aa 1>>>pF1KE5171 161 - 161 aa - 161 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.9126+/-0.000259; mu= 10.0933+/- 0.016 mean_var=75.6139+/-15.508, 0's: 0 Z-trim(121.0): 1 B-trim: 2194 in 1/51 Lambda= 0.147494 statistics sampled from 37019 (37020) to 37019 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.796), E-opt: 0.2 (0.434), width: 16 Scan time: 5.050 The best scores are: opt bits E(85289) NP_060377 (OMIM: 613510) ragulator complex protein ( 161) 1046 230.7 7.7e-61 >>NP_060377 (OMIM: 613510) ragulator complex protein LAM (161 aa) initn: 1046 init1: 1046 opt: 1046 Z-score: 1213.3 bits: 230.7 E(85289): 7.7e-61 Smith-Waterman score: 1046; 100.0% identity (100.0% similar) in 161 aa overlap (1-161:1-161) 10 20 30 40 50 60 pF1KE5 MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_060 MGCCYSSENEDSDQDREERKLLLDPSSPPTKALNGAEPNYHSLPSARTDEQALLSSILAK 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 TASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_060 TASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQPHQVLA 70 80 90 100 110 120 130 140 150 160 pF1KE5 SEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP ::::::::::::::::::::::::::::::::::::::::: NP_060 SEPIPFSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP 130 140 150 160 161 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:15:54 2016 done: Mon Nov 7 22:15:54 2016 Total Scan time: 5.050 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]