FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5174, 166 aa 1>>>pF1KE5174 166 - 166 aa - 166 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 7.4736+/-0.000268; mu= 3.4244+/- 0.017 mean_var=131.9129+/-26.359, 0's: 0 Z-trim(123.4): 1 B-trim: 0 in 0/50 Lambda= 0.111668 statistics sampled from 43275 (43276) to 43275 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.825), E-opt: 0.2 (0.507), width: 16 Scan time: 5.120 The best scores are: opt bits E(85289) NP_004918 (OMIM: 606866) 39S ribosomal protein L49 ( 166) 1171 198.5 4.1e-51 >>NP_004918 (OMIM: 606866) 39S ribosomal protein L49, mi (166 aa) initn: 1171 init1: 1171 opt: 1171 Z-score: 1038.6 bits: 198.5 E(85289): 4.1e-51 Smith-Waterman score: 1171; 100.0% identity (100.0% similar) in 166 aa overlap (1-166:1-166) 10 20 30 40 50 60 pF1KE5 MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVERLLPATRIPDP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVERLLPATRIPDP 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 PKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWAL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_004 PKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWAL 70 80 90 100 110 120 130 140 150 160 pF1KE5 QKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF :::::::::::::::::::::::::::::::::::::::::::::: NP_004 QKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF 130 140 150 160 166 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:17:50 2016 done: Mon Nov 7 22:17:51 2016 Total Scan time: 5.120 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]