FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5174, 166 aa 1>>>pF1KE5174 166 - 166 aa - 166 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 6.8629+/-0.000642; mu= 7.0983+/- 0.039 mean_var=125.8345+/-25.119, 0's: 0 Z-trim(115.8): 2 B-trim: 0 in 0/51 Lambda= 0.114334 statistics sampled from 16354 (16356) to 16354 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.825), E-opt: 0.2 (0.502), width: 16 Scan time: 2.120 The best scores are: opt bits E(32554) CCDS8096.1 MRPL49 gene_id:740|Hs108|chr11 ( 166) 1171 202.8 8.2e-53 >>CCDS8096.1 MRPL49 gene_id:740|Hs108|chr11 (166 aa) initn: 1171 init1: 1171 opt: 1171 Z-score: 1061.7 bits: 202.8 E(32554): 8.2e-53 Smith-Waterman score: 1171; 100.0% identity (100.0% similar) in 166 aa overlap (1-166:1-166) 10 20 30 40 50 60 pF1KE5 MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVERLLPATRIPDP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS80 MAATMFRATLRGWRTGVQRGCGLRLLSQTQGPPDYPRFVESVDEYQFVERLLPATRIPDP 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 PKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWAL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS80 PKHEHYPTPSGWQPPRDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTVIRKVEGDIWAL 70 80 90 100 110 120 130 140 150 160 pF1KE5 QKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF :::::::::::::::::::::::::::::::::::::::::::::: CCDS80 QKDVEDFLSPLLGKTPVTQVNEVTGTLRIKGYFDQELKAWLLEKGF 130 140 150 160 166 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:17:49 2016 done: Mon Nov 7 22:17:50 2016 Total Scan time: 2.120 Total Display time: -0.040 Function used was FASTA [36.3.4 Apr, 2011]