FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6193, 90 aa
  1>>>pF1KE6193 90 - 90 aa - 90 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 4.8807+/-0.000549; mu= 11.0919+/- 0.033
 mean_var=57.7488+/-11.155, 0's: 0 Z-trim(112.4): 8  B-trim: 0 in 0/54
 Lambda= 0.168773
 statistics sampled from 13194 (13201) to 13194 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.799), E-opt: 0.2 (0.406), width:  16
 Scan time:  1.190

The best scores are:                                      opt bits E(32554)
CCDS7959.1 TIMM10 gene_id:26519|Hs108|chr11        (  90)  607 154.9 6.3e-39


>>CCDS7959.1 TIMM10 gene_id:26519|Hs108|chr11             (90 aa)
 initn: 607 init1: 607 opt: 607  Z-score: 812.3  bits: 154.9 E(32554): 6.3e-39
Smith-Waterman score: 607; 100.0% identity (100.0% similar) in 90 aa overlap (1-90:1-90)

               10        20        30        40        50        60
pF1KE6 MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLD
       ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS79 MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLD
               10        20        30        40        50        60

               70        80        90
pF1KE6 IHERMGKKLTELSMQDEELMKRVQQSSGPA
       ::::::::::::::::::::::::::::::
CCDS79 IHERMGKKLTELSMQDEELMKRVQQSSGPA
               70        80        90




90 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 10:14:08 2016 done: Tue Nov  8 10:14:08 2016
 Total Scan time:  1.190 Total Display time: -0.030

Function used was FASTA [36.3.4 Apr, 2011]