FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3024, 141 aa 1>>>pF1KE3024 141 - 141 aa - 141 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.9823+/-0.000266; mu= 14.0731+/- 0.017 mean_var=65.3886+/-12.977, 0's: 0 Z-trim(119.8): 6 B-trim: 0 in 0/56 Lambda= 0.158607 statistics sampled from 34230 (34236) to 34230 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.782), E-opt: 0.2 (0.401), width: 16 Scan time: 5.420 The best scores are: opt bits E(85289) XP_016873773 (OMIM: 114130) PREDICTED: calcitonin ( 141) 928 219.9 1.1e-57 XP_016873772 (OMIM: 114130) PREDICTED: calcitonin ( 141) 928 219.9 1.1e-57 NP_001732 (OMIM: 114130) calcitonin isoform CT pre ( 141) 928 219.9 1.1e-57 NP_001029124 (OMIM: 114130) calcitonin isoform CT ( 141) 928 219.9 1.1e-57 NP_001029125 (OMIM: 114130) calcitonin gene-relate ( 128) 489 119.4 1.7e-27 NP_000719 (OMIM: 114160) calcitonin gene-related p ( 127) 435 107.1 9e-24 >>XP_016873773 (OMIM: 114130) PREDICTED: calcitonin isof (141 aa) initn: 928 init1: 928 opt: 928 Z-score: 1156.8 bits: 219.9 E(85289): 1.1e-57 Smith-Waterman score: 928; 100.0% identity (100.0% similar) in 141 aa overlap (1-141:1-141) 10 20 30 40 50 60 pF1KE3 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR 70 80 90 100 110 120 130 140 pF1KE3 DMSSDLERDHRPHVSMPQNAN ::::::::::::::::::::: XP_016 DMSSDLERDHRPHVSMPQNAN 130 140 >>XP_016873772 (OMIM: 114130) PREDICTED: calcitonin isof (141 aa) initn: 928 init1: 928 opt: 928 Z-score: 1156.8 bits: 219.9 E(85289): 1.1e-57 Smith-Waterman score: 928; 100.0% identity (100.0% similar) in 141 aa overlap (1-141:1-141) 10 20 30 40 50 60 pF1KE3 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: XP_016 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR 70 80 90 100 110 120 130 140 pF1KE3 DMSSDLERDHRPHVSMPQNAN ::::::::::::::::::::: XP_016 DMSSDLERDHRPHVSMPQNAN 130 140 >>NP_001732 (OMIM: 114130) calcitonin isoform CT preprop (141 aa) initn: 928 init1: 928 opt: 928 Z-score: 1156.8 bits: 219.9 E(85289): 1.1e-57 Smith-Waterman score: 928; 100.0% identity (100.0% similar) in 141 aa overlap (1-141:1-141) 10 20 30 40 50 60 pF1KE3 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR 70 80 90 100 110 120 130 140 pF1KE3 DMSSDLERDHRPHVSMPQNAN ::::::::::::::::::::: NP_001 DMSSDLERDHRPHVSMPQNAN 130 140 >>NP_001029124 (OMIM: 114130) calcitonin isoform CT prep (141 aa) initn: 928 init1: 928 opt: 928 Z-score: 1156.8 bits: 219.9 E(85289): 1.1e-57 Smith-Waterman score: 928; 100.0% identity (100.0% similar) in 141 aa overlap (1-141:1-141) 10 20 30 40 50 60 pF1KE3 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKR 70 80 90 100 110 120 130 140 pF1KE3 DMSSDLERDHRPHVSMPQNAN ::::::::::::::::::::: NP_001 DMSSDLERDHRPHVSMPQNAN 130 140 >>NP_001029125 (OMIM: 114130) calcitonin gene-related pe (128 aa) initn: 491 init1: 466 opt: 489 Z-score: 614.5 bits: 119.4 E(85289): 1.7e-27 Smith-Waterman score: 489; 68.0% identity (80.0% similar) in 125 aa overlap (1-120:1-123) 10 20 30 40 50 60 pF1KE3 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_001 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ 10 20 30 40 50 60 70 80 90 100 110 pF1KE3 MKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKF-----HTFPQTAIGVGA ::::::::::::::: . . .:: . .::. . ... ..: : .: : NP_001 MKASELEQEQEREGSRIIA--QKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKA 70 80 90 100 110 120 130 140 pF1KE3 PGKKRDMSSDLERDHRPHVSMPQNAN :..: NP_001 FGRRRRDLQA 120 >>NP_000719 (OMIM: 114160) calcitonin gene-related pepti (127 aa) initn: 258 init1: 220 opt: 435 Z-score: 547.8 bits: 107.1 E(85289): 9e-24 Smith-Waterman score: 435; 63.2% identity (78.4% similar) in 125 aa overlap (1-120:1-122) 10 20 30 40 50 60 pF1KE3 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ :::.::::::::::::: :::::.:::::::::::: ::::::...:::::::::::::: NP_000 MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSP-DPATLSKEDARLLLAALVQDYVQ 10 20 30 40 50 70 80 90 100 110 pF1KE3 MKASELEQEQEREGSSLDSPRSKRCGNLSTC----MLGTYTQDFNKFHT-FPQTAIGVGA ::::::.:::: .::: : .:: : .:: . : ... . .. : : .: : NP_000 MKASELKQEQETQGSS--SAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKA 60 70 80 90 100 110 120 130 140 pF1KE3 PGKKRDMSSDLERDHRPHVSMPQNAN :..: NP_000 FGRRRRDLQA 120 141 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 04:57:19 2016 done: Sun Nov 6 04:57:20 2016 Total Scan time: 5.420 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]