FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5183, 115 aa 1>>>pF1KE5183 115 - 115 aa - 115 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.9466+/-0.000559; mu= 10.0262+/- 0.034 mean_var=96.3066+/-19.074, 0's: 0 Z-trim(116.1): 5 B-trim: 0 in 0/51 Lambda= 0.130691 statistics sampled from 16715 (16719) to 16715 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.824), E-opt: 0.2 (0.514), width: 16 Scan time: 1.870 The best scores are: opt bits E(32554) CCDS7717.1 RPLP2 gene_id:6181|Hs108|chr11 ( 115) 719 143.8 2.2e-35 >>CCDS7717.1 RPLP2 gene_id:6181|Hs108|chr11 (115 aa) initn: 719 init1: 719 opt: 719 Z-score: 748.9 bits: 143.8 E(32554): 2.2e-35 Smith-Waterman score: 719; 100.0% identity (100.0% similar) in 115 aa overlap (1-115:1-115) 10 20 30 40 50 60 pF1KE5 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS77 MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIG 10 20 30 40 50 60 70 80 90 100 110 pF1KE5 KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD ::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS77 KLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD 70 80 90 100 110 115 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:22:23 2016 done: Mon Nov 7 22:22:23 2016 Total Scan time: 1.870 Total Display time: -0.050 Function used was FASTA [36.3.4 Apr, 2011]