FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3022, 136 aa 1>>>pF1KE3022 136 - 136 aa - 136 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.8348+/-0.000273; mu= 14.0559+/- 0.017 mean_var=63.9473+/-12.675, 0's: 0 Z-trim(119.8): 1 B-trim: 0 in 0/57 Lambda= 0.160385 statistics sampled from 34199 (34200) to 34199 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.776), E-opt: 0.2 (0.401), width: 16 Scan time: 4.880 The best scores are: opt bits E(85289) NP_937823 (OMIM: 609795) orexigenic neuropeptide Q ( 136) 955 228.6 2.5e-60 >>NP_937823 (OMIM: 609795) orexigenic neuropeptide QRFP (136 aa) initn: 955 init1: 955 opt: 955 Z-score: 1204.1 bits: 228.6 E(85289): 2.5e-60 Smith-Waterman score: 955; 100.0% identity (100.0% similar) in 136 aa overlap (1-136:1-136) 10 20 30 40 50 60 pF1KE3 MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_937 MVRPYPLIYFLFLPLGACFPLLDRREPTDAMGGLGAGERWADLAMGPRPHSVWGSSRWLR 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 ASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_937 ASQPQALLVIARGLQTSGREHAGCRFRFGRQDEGSEATGFLPAAGEKTSGPLGNLAEELN 70 80 90 100 110 120 130 pF1KE3 GYSRKKGGFSFRFGRR :::::::::::::::: NP_937 GYSRKKGGFSFRFGRR 130 136 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 15:40:10 2016 done: Sun Nov 6 15:40:11 2016 Total Scan time: 4.880 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]