FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3001, 68 aa 1>>>pF1KE3001 68 - 68 aa - 68 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.6169+/-0.000258; mu= 9.8703+/- 0.016 mean_var=49.2496+/- 9.783, 0's: 0 Z-trim(120.7): 6 B-trim: 2188 in 2/53 Lambda= 0.182757 statistics sampled from 36177 (36183) to 36177 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.803), E-opt: 0.2 (0.424), width: 16 Scan time: 3.700 The best scores are: opt bits E(85289) NP_005209 (OMIM: 602056) beta-defensin 1 prepropro ( 68) 482 133.6 2.4e-32 NP_004933 (OMIM: 602215) beta-defensin 4A precurso ( 64) 123 38.9 0.00071 NP_061131 (OMIM: 606611) beta-defensin 103 precurs ( 67) 115 36.8 0.0032 >>NP_005209 (OMIM: 602056) beta-defensin 1 preproprotein (68 aa) initn: 482 init1: 482 opt: 482 Z-score: 701.7 bits: 133.6 E(85289): 2.4e-32 Smith-Waterman score: 482; 100.0% identity (100.0% similar) in 68 aa overlap (1-68:1-68) 10 20 30 40 50 60 pF1KE3 MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_005 MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY 10 20 30 40 50 60 pF1KE3 RGKAKCCK :::::::: NP_005 RGKAKCCK >>NP_004933 (OMIM: 602215) beta-defensin 4A precursor [H (64 aa) initn: 121 init1: 99 opt: 123 Z-score: 190.5 bits: 38.9 E(85289): 0.00071 Smith-Waterman score: 123; 39.7% identity (54.4% similar) in 68 aa overlap (1-68:1-62) 10 20 30 40 50 60 pF1KE3 MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCY ::. :::. : ..: : : : :.: : .:..::. : :: : ::: NP_004 MRVLYLLFSFLFIFL--MPLPGVF-GGIG---DPVTCLKSGAICHPVFCPRRYKQIGTCG 10 20 30 40 50 pF1KE3 RGKAKCCK .:::: NP_004 LPGTKCCKKP 60 >>NP_061131 (OMIM: 606611) beta-defensin 103 precursor [ (67 aa) initn: 122 init1: 66 opt: 115 Z-score: 178.8 bits: 36.8 E(85289): 0.0032 Smith-Waterman score: 115; 35.7% identity (57.1% similar) in 70 aa overlap (1-68:1-64) 10 20 30 40 50 pF1KE3 MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSAC-PIFTKIQGTC :: :::. : :.: . . :.... : ..: : ::.: .: : .: : : NP_061 MRIHYLLFALLFLFLVPVPGHGGIINTL----QKYYCRVRGGRCAVLSCLPKEEQI-GKC 10 20 30 40 50 60 pF1KE3 Y-RGKAKCCK ::. :::. NP_061 STRGR-KCCRRKK 60 68 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 04:31:15 2016 done: Sun Nov 6 04:31:15 2016 Total Scan time: 3.700 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]