FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE5165, 140 aa 1>>>pF1KE5165 140 - 140 aa - 140 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3613+/-0.000318; mu= 10.4275+/- 0.020 mean_var=55.3760+/-10.854, 0's: 0 Z-trim(115.4): 1 B-trim: 20 in 1/51 Lambda= 0.172351 statistics sampled from 25846 (25847) to 25846 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.698), E-opt: 0.2 (0.303), width: 16 Scan time: 4.760 The best scores are: opt bits E(85289) NP_005828 (OMIM: 606113) ribonuclease P protein su ( 140) 906 232.9 1.3e-61 >>NP_005828 (OMIM: 606113) ribonuclease P protein subuni (140 aa) initn: 906 init1: 906 opt: 906 Z-score: 1227.2 bits: 232.9 E(85289): 1.3e-61 Smith-Waterman score: 906; 100.0% identity (100.0% similar) in 140 aa overlap (1-140:1-140) 10 20 30 40 50 60 pF1KE5 MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGA :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_005 MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGA 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE5 RGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_005 RGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREP 70 80 90 100 110 120 130 140 pF1KE5 LTRIRNNSAIHIRVFRVTPK :::::::::::::::::::: NP_005 LTRIRNNSAIHIRVFRVTPK 130 140 140 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 22:12:43 2016 done: Mon Nov 7 22:12:43 2016 Total Scan time: 4.760 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]