FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011
Please cite:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448

Query: pF1KE6163, 55 aa
  1>>>pF1KE6163 55 - 55 aa - 55 aa
Library: human.CCDS.faa
  18511270 residues in 32554 sequences

Statistics:  Expectation_n fit: rho(ln(x))= 3.8676+/-0.000391; mu= 12.6274+/- 0.024
 mean_var=37.9243+/- 7.666, 0's: 0 Z-trim(117.4): 4  B-trim: 1091 in 1/52
 Lambda= 0.208264
 statistics sampled from 18124 (18127) to 18124 sequences
Algorithm: FASTA (3.7 Nov 2010) [optimized]
Parameters: BL50 matrix (15:-5), open/ext: -10/-2
 ktup: 2, E-join: 1 (0.9), E-opt: 0.2 (0.557), width:  16
 Scan time:  1.280

The best scores are:                                      opt bits E(32554)
CCDS5376.1 TOMM7 gene_id:54543|Hs108|chr7          (  55)  376 117.8 3.5e-28


>>CCDS5376.1 TOMM7 gene_id:54543|Hs108|chr7               (55 aa)
 initn: 376 init1: 376 opt: 376  Z-score: 619.5  bits: 117.8 E(32554): 3.5e-28
Smith-Waterman score: 376; 100.0% identity (100.0% similar) in 55 aa overlap (1-55:1-55)

               10        20        30        40        50     
pF1KE6 MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
       :::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCDS53 MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
               10        20        30        40        50     




55 residues in 1 query   sequences
18511270 residues in 32554 library sequences
 Tcomplib [36.3.4 Apr, 2011] (8 proc)
 start: Tue Nov  8 09:59:14 2016 done: Tue Nov  8 09:59:14 2016
 Total Scan time:  1.280 Total Display time: -0.040

Function used was FASTA [36.3.4 Apr, 2011]