FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6531, 198 aa 1>>>pF1KE6531 198 - 198 aa - 198 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.8438+/-0.000856; mu= 11.8517+/- 0.052 mean_var=77.2769+/-15.051, 0's: 0 Z-trim(107.6): 11 B-trim: 0 in 0/50 Lambda= 0.145898 statistics sampled from 9656 (9663) to 9656 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.674), E-opt: 0.2 (0.297), width: 16 Scan time: 2.010 The best scores are: opt bits E(32554) CCDS5310.1 TCTE3 gene_id:6991|Hs108|chr6 ( 198) 1301 282.7 1e-76 >>CCDS5310.1 TCTE3 gene_id:6991|Hs108|chr6 (198 aa) initn: 1301 init1: 1301 opt: 1301 Z-score: 1490.8 bits: 282.7 E(32554): 1e-76 Smith-Waterman score: 1301; 100.0% identity (100.0% similar) in 198 aa overlap (1-198:1-198) 10 20 30 40 50 60 pF1KE6 MEKRGRGVKSSPIQTPNQTPQQAPVTPRKERRPSMFEKEAYTQILRERLRESIHNVQYVE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS53 MEKRGRGVKSSPIQTPNQTPQQAPVTPRKERRPSMFEKEAYTQILRERLRESIHNVQYVE 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 PPFDDSIADIGKEWKSALAKLKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS53 PPFDDSIADIGKEWKSALAKLKFANSYRMEPLKKFQAHSVETKVQQILTESLKDVKYDDK 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE6 VFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAK :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS53 VFSHLSLELADRILLAVKEFGYHRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAK 130 140 150 160 170 180 190 pF1KE6 HEAESYVALVLVFALYYE :::::::::::::::::: CCDS53 HEAESYVALVLVFALYYE 190 198 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 14:09:04 2016 done: Tue Nov 8 14:09:05 2016 Total Scan time: 2.010 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]