FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3058, 213 aa 1>>>pF1KE3058 213 - 213 aa - 213 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.2417+/-0.000325; mu= 15.0546+/- 0.020 mean_var=69.7840+/-13.742, 0's: 0 Z-trim(116.0): 7 B-trim: 71 in 1/52 Lambda= 0.153531 statistics sampled from 26844 (26847) to 26844 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.679), E-opt: 0.2 (0.315), width: 16 Scan time: 6.220 The best scores are: opt bits E(85289) NP_612417 (OMIM: 611784) general transcription fac ( 213) 1408 320.3 1.5e-87 >>NP_612417 (OMIM: 611784) general transcription factor (213 aa) initn: 1408 init1: 1408 opt: 1408 Z-score: 1692.8 bits: 320.3 E(85289): 1.5e-87 Smith-Waterman score: 1408; 100.0% identity (100.0% similar) in 213 aa overlap (1-213:1-213) 10 20 30 40 50 60 pF1KE3 MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_612 MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSC 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 VFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENI :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_612 VFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENI 70 80 90 100 110 120 130 140 150 160 170 180 pF1KE3 GGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_612 GGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQ 130 140 150 160 170 180 190 200 210 pF1KE3 EKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP ::::::::::::::::::::::::::::::::: NP_612 EKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP 190 200 210 213 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 06:04:23 2016 done: Sun Nov 6 06:04:24 2016 Total Scan time: 6.220 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]