FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE6501, 136 aa 1>>>pF1KE6501 136 - 136 aa - 136 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 11.5690+/-0.000335; mu= -15.4258+/- 0.021 mean_var=458.7979+/-95.710, 0's: 0 Z-trim(128.4): 2 B-trim: 1077 in 1/60 Lambda= 0.059877 statistics sampled from 59405 (59419) to 59405 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.903), E-opt: 0.2 (0.697), width: 16 Scan time: 4.010 The best scores are: opt bits E(85289) NP_054788 (OMIM: 613526) psoriasis susceptibility ( 136) 1074 104.7 4.7e-23 >>NP_054788 (OMIM: 613526) psoriasis susceptibility 1 ca (136 aa) initn: 1074 init1: 1074 opt: 1074 Z-score: 534.9 bits: 104.7 E(85289): 4.7e-23 Smith-Waterman score: 1074; 100.0% identity (100.0% similar) in 136 aa overlap (1-136:1-136) 10 20 30 40 50 60 pF1KE6 MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_054 MILNWKLLGILVLCLHTRGISGSEGHPSHPPAEDREEAGSPTLPQGPPVPGDPWPGAPPL 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE6 FEDPPPTRPSRPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDN :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_054 FEDPPPTRPSRPWRDLPETGVWLPEPPRTDPPQPPRPDDPWPAGPQPPENPWPPAPEVDN 70 80 90 100 110 120 130 pF1KE6 RPQEEPDLDPPREEYR :::::::::::::::: NP_054 RPQEEPDLDPPREEYR 130 136 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Tue Nov 8 13:53:26 2016 done: Tue Nov 8 13:53:27 2016 Total Scan time: 4.010 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]