FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1603, 104 aa 1>>>pF1KE1603 104 - 104 aa - 104 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.0307+/-0.000597; mu= 11.5249+/- 0.036 mean_var=62.2356+/-12.332, 0's: 0 Z-trim(111.8): 4 B-trim: 0 in 0/51 Lambda= 0.162575 statistics sampled from 12672 (12675) to 12672 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.774), E-opt: 0.2 (0.389), width: 16 Scan time: 1.670 The best scores are: opt bits E(32554) CCDS4456.1 SCGB3A1 gene_id:92304|Hs108|chr5 ( 104) 642 158.0 9.7e-40 >>CCDS4456.1 SCGB3A1 gene_id:92304|Hs108|chr5 (104 aa) initn: 642 init1: 642 opt: 642 Z-score: 826.9 bits: 158.0 E(32554): 9.7e-40 Smith-Waterman score: 642; 100.0% identity (100.0% similar) in 104 aa overlap (1-104:1-104) 10 20 30 40 50 60 pF1KE1 MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS44 MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLL 10 20 30 40 50 60 70 80 90 100 pF1KE1 LSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG :::::::::::::::::::::::::::::::::::::::::::: CCDS44 LSSLGIPVNHLIEGSQKCVAELGPQAVGAVKALKALLGALTVFG 70 80 90 100 104 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 17:01:31 2016 done: Sun Nov 6 17:01:31 2016 Total Scan time: 1.670 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]