FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1635, 151 aa 1>>>pF1KE1635 151 - 151 aa - 151 aa Library: /omim/omim.rfq.tfa 60827320 residues in 85289 sequences Statistics: Expectation_n fit: rho(ln(x))= 4.6884+/-0.000339; mu= 15.0241+/- 0.021 mean_var=62.0366+/-12.804, 0's: 0 Z-trim(116.0): 19 B-trim: 1020 in 1/49 Lambda= 0.162836 statistics sampled from 26770 (26774) to 26770 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.704), E-opt: 0.2 (0.314), width: 16 Scan time: 4.170 The best scores are: opt bits E(85289) NP_002293 (OMIM: 602882) leukocyte cell-derived ch ( 151) 1034 250.8 6e-67 >>NP_002293 (OMIM: 602882) leukocyte cell-derived chemot (151 aa) initn: 1034 init1: 1034 opt: 1034 Z-score: 1322.9 bits: 250.8 E(85289): 6e-67 Smith-Waterman score: 1034; 99.3% identity (100.0% similar) in 151 aa overlap (1-151:1-151) 10 20 30 40 50 60 pF1KE1 MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:: NP_002 MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILC 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 SAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: NP_002 SAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKL 70 80 90 100 110 120 130 140 150 pF1KE1 GTLLPLQKVYPGIQSHVHIENCDSSDPTAYL ::::::::::::::::::::::::::::::: NP_002 GTLLPLQKVYPGIQSHVHIENCDSSDPTAYL 130 140 150 151 residues in 1 query sequences 60827320 residues in 85289 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 17:08:19 2016 done: Sun Nov 6 17:08:20 2016 Total Scan time: 4.170 Total Display time: -0.030 Function used was FASTA [36.3.4 Apr, 2011]