FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE1635, 151 aa 1>>>pF1KE1635 151 - 151 aa - 151 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.1432+/-0.000696; mu= 12.4570+/- 0.042 mean_var=61.5892+/-12.383, 0's: 0 Z-trim(109.4): 12 B-trim: 0 in 0/50 Lambda= 0.163426 statistics sampled from 10894 (10896) to 10894 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.722), E-opt: 0.2 (0.335), width: 16 Scan time: 1.470 The best scores are: opt bits E(32554) CCDS4190.1 LECT2 gene_id:3950|Hs108|chr5 ( 151) 1034 251.7 1.3e-67 >>CCDS4190.1 LECT2 gene_id:3950|Hs108|chr5 (151 aa) initn: 1034 init1: 1034 opt: 1034 Z-score: 1327.3 bits: 251.7 E(32554): 1.3e-67 Smith-Waterman score: 1034; 99.3% identity (100.0% similar) in 151 aa overlap (1-151:1-151) 10 20 30 40 50 60 pF1KE1 MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLC :::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:: CCDS41 MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDILC 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE1 SAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS41 SAGSTVYAPFTGMIVGQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKL 70 80 90 100 110 120 130 140 150 pF1KE1 GTLLPLQKVYPGIQSHVHIENCDSSDPTAYL ::::::::::::::::::::::::::::::: CCDS41 GTLLPLQKVYPGIQSHVHIENCDSSDPTAYL 130 140 150 151 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 17:08:19 2016 done: Sun Nov 6 17:08:19 2016 Total Scan time: 1.470 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]