FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE2147, 124 aa 1>>>pF1KE2147 124 - 124 aa - 124 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.6024+/-0.000598; mu= 8.7988+/- 0.036 mean_var=62.2765+/-12.878, 0's: 0 Z-trim(111.4): 9 B-trim: 0 in 0/52 Lambda= 0.162522 statistics sampled from 12379 (12382) to 12379 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.761), E-opt: 0.2 (0.38), width: 16 Scan time: 1.640 The best scores are: opt bits E(32554) CCDS3866.1 NDUFS6 gene_id:4726|Hs108|chr5 ( 124) 858 208.9 6.5e-55 >>CCDS3866.1 NDUFS6 gene_id:4726|Hs108|chr5 (124 aa) initn: 858 init1: 858 opt: 858 Z-score: 1099.4 bits: 208.9 E(32554): 6.5e-55 Smith-Waterman score: 858; 100.0% identity (100.0% similar) in 124 aa overlap (1-124:1-124) 10 20 30 40 50 60 pF1KE2 MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQ :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS38 MAAAMTFCRLLNRCGEAARSLPLGARCFGVRVSPTGEKVTHTGQVYDDKDYRRIRFVGRQ 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE2 KEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS38 KEVNENFAIDLIAEQPVSEVETRVIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR 70 80 90 100 110 120 pF1KE2 QHHH :::: CCDS38 QHHH 124 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Mon Nov 7 15:54:23 2016 done: Mon Nov 7 15:54:23 2016 Total Scan time: 1.640 Total Display time: -0.010 Function used was FASTA [36.3.4 Apr, 2011]