FASTA searches a protein or DNA sequence data bank 36.3.4 Apr, 2011 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448 Query: pF1KE3970, 153 aa 1>>>pF1KE3970 153 - 153 aa - 153 aa Library: human.CCDS.faa 18511270 residues in 32554 sequences Statistics: Expectation_n fit: rho(ln(x))= 5.3932+/-0.000579; mu= 12.1912+/- 0.035 mean_var=100.5574+/-21.159, 0's: 0 Z-trim(115.1): 116 B-trim: 0 in 0/51 Lambda= 0.127899 statistics sampled from 15546 (15692) to 15546 sequences Algorithm: FASTA (3.7 Nov 2010) [optimized] Parameters: BL50 matrix (15:-5), open/ext: -10/-2 ktup: 2, E-join: 1 (0.828), E-opt: 0.2 (0.482), width: 16 Scan time: 1.940 The best scores are: opt bits E(32554) CCDS1981.1 RNF181 gene_id:51255|Hs108|chr2 ( 153) 1085 209.3 7.3e-55 >>CCDS1981.1 RNF181 gene_id:51255|Hs108|chr2 (153 aa) initn: 1085 init1: 1085 opt: 1085 Z-score: 1098.5 bits: 209.3 E(32554): 7.3e-55 Smith-Waterman score: 1085; 100.0% identity (100.0% similar) in 153 aa overlap (1-153:1-153) 10 20 30 40 50 60 pF1KE3 MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVE :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS19 MASYFDEHDCEPSDPEQETRTNMLLELARSLFNRMDFEDLGLVVDWDHHLPPPAAKTVVE 10 20 30 40 50 60 70 80 90 100 110 120 pF1KE3 NLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYEL :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: CCDS19 NLPRTVIRGSQAELKCPVCLLEFEEEETAIEMPCHHLFHSSCILPWLSKTNSCPLCRYEL 70 80 90 100 110 120 130 140 150 pF1KE3 PTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT ::::::::::::::::::::::::::::::::: CCDS19 PTDDDTYEEHRRDKARKQQQQHRLENLHGAMYT 130 140 150 153 residues in 1 query sequences 18511270 residues in 32554 library sequences Tcomplib [36.3.4 Apr, 2011] (8 proc) start: Sun Nov 6 08:27:50 2016 done: Sun Nov 6 08:27:50 2016 Total Scan time: 1.940 Total Display time: -0.020 Function used was FASTA [36.3.4 Apr, 2011]